93
|
Vector Laboratories
fitc avidin Fitc Avidin, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/fitc avidin/product/Vector Laboratories Average 93 stars, based on 1 article reviews
fitc avidin - by Bioz Stars,
2026-04
93/100 stars
|
Buy from Supplier |
90
|
MathWorks Inc
matlab r 2007b Matlab R 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/matlab r 2007b/product/MathWorks Inc Average 90 stars, based on 1 article reviews
matlab r 2007b - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
90
|
MathWorks Inc
r 2007 b R 2007 B, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/r 2007 b/product/MathWorks Inc Average 90 stars, based on 1 article reviews
r 2007 b - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
90
|
Ansary Labs
trunk stabilisation exercises Trunk Stabilisation Exercises, supplied by Ansary Labs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/trunk stabilisation exercises/product/Ansary Labs Average 90 stars, based on 1 article reviews
trunk stabilisation exercises - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
90
|
MathWorks Inc
matlabv r 2007b Matlabv R 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/matlabv r 2007b/product/MathWorks Inc Average 90 stars, based on 1 article reviews
matlabv r 2007b - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
90
|
MathWorks Inc
r© version 2007b R© Version 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/r© version 2007b/product/MathWorks Inc Average 90 stars, based on 1 article reviews
r© version 2007b - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
93
|
Vector Laboratories
bovine serum albumin Bovine Serum Albumin, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/bovine serum albumin/product/Vector Laboratories Average 93 stars, based on 1 article reviews
bovine serum albumin - by Bioz Stars,
2026-04
93/100 stars
|
Buy from Supplier |
90
|
Rosenheimer Technische Arbeitsmittel
transfluthrin Transfluthrin, supplied by Rosenheimer Technische Arbeitsmittel, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/transfluthrin/product/Rosenheimer Technische Arbeitsmittel Average 90 stars, based on 1 article reviews
transfluthrin - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
90
|
Bioscientifica Ltd
ghrelin receptor Ghrelin Receptor, supplied by Bioscientifica Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ghrelin receptor/product/Bioscientifica Ltd Average 90 stars, based on 1 article reviews
ghrelin receptor - by Bioz Stars,
2026-04
90/100 stars
|
Buy from Supplier |
N/A
|
There are five tubulins in human cells alpha beta gamma delta and epsilon Tubulins are conserved across species They form heterodimers which multimerize to form a microtubule filament An alpha and beta tubulin heterodimer is
|
Buy from Supplier |
N/A
|
MAP2K2 antibody was raised using the C terminal of MAP2K2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV. Rabbit polyclonal MAP2K2 antibody raised against the C terminal of MAP2K2.
|
Buy from Supplier |