r 2007 b Search Results


93
Vector Laboratories fitc avidin
Fitc Avidin, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/fitc avidin/product/Vector Laboratories
Average 93 stars, based on 1 article reviews
fitc avidin - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

90
MathWorks Inc matlab r 2007b
Matlab R 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/matlab r 2007b/product/MathWorks Inc
Average 90 stars, based on 1 article reviews
matlab r 2007b - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
MathWorks Inc r 2007 b
R 2007 B, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/r 2007 b/product/MathWorks Inc
Average 90 stars, based on 1 article reviews
r 2007 b - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Ansary Labs trunk stabilisation exercises
Trunk Stabilisation Exercises, supplied by Ansary Labs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/trunk stabilisation exercises/product/Ansary Labs
Average 90 stars, based on 1 article reviews
trunk stabilisation exercises - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
MathWorks Inc matlabv r 2007b
Matlabv R 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/matlabv r 2007b/product/MathWorks Inc
Average 90 stars, based on 1 article reviews
matlabv r 2007b - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
MathWorks Inc r© version 2007b
R© Version 2007b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/r© version 2007b/product/MathWorks Inc
Average 90 stars, based on 1 article reviews
r© version 2007b - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

93
Vector Laboratories bovine serum albumin
Bovine Serum Albumin, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/bovine serum albumin/product/Vector Laboratories
Average 93 stars, based on 1 article reviews
bovine serum albumin - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

90
Rosenheimer Technische Arbeitsmittel transfluthrin
Transfluthrin, supplied by Rosenheimer Technische Arbeitsmittel, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/transfluthrin/product/Rosenheimer Technische Arbeitsmittel
Average 90 stars, based on 1 article reviews
transfluthrin - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Bioscientifica Ltd ghrelin receptor
Ghrelin Receptor, supplied by Bioscientifica Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ghrelin receptor/product/Bioscientifica Ltd
Average 90 stars, based on 1 article reviews
ghrelin receptor - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

N/A
Recombinant human RPS3 protein (His tag)
  Buy from Supplier

N/A
There are five tubulins in human cells alpha beta gamma delta and epsilon Tubulins are conserved across species They form heterodimers which multimerize to form a microtubule filament An alpha and beta tubulin heterodimer is
  Buy from Supplier

N/A
MAP2K2 antibody was raised using the C terminal of MAP2K2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV. Rabbit polyclonal MAP2K2 antibody raised against the C terminal of MAP2K2.
  Buy from Supplier

Image Search Results